SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007924 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007924
Domain Number 1 Region: 167-367
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.65e-55
Family Prokaryotic proteases 0.000002
Further Details:      
 
Domain Number 2 Region: 382-476
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-17
Family HtrA-like serine proteases 0.0035
Further Details:      
 
Domain Number 3 Region: 38-120
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 4 Region: 104-152
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000116
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007924   Gene: ENSMMUG00000006037   Transcript: ENSMMUT00000008435
Sequence length 479
Comment pep:known chromosome:MMUL_1:8:39453748:39468510:1 gene:ENSMMUG00000006037 transcript:ENSMMUT00000008435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRPQLRPAGLGRCLLPGLLLLLVPVLWAGAARLHTQLACPAVCQPTRCPALPTCSLGTT
PVLDLCRCCRVCPAAEGQVCGGTQGQPCAPGLQCLKPLRPGLPSTCGCPTKGVAVCGSDR
RTYPSLCALRTENRAARRLGNISAVPVQWGDCGDTGSRRAGTLRRNYNFIAAVVEKVAPS
VVHMQLWGRLLHGRMPVPVYSGSGFIVSEDGLIITNAHVVRNQQWIEVVLQNGARYEAVV
KDIDLKLDLAVIKIEPNADLPVLMLGRSSDLRAGEFVVALGSPVSLQNTATAGIVSTKQR
KGKELGMKDSDIDYVQIDAAINPGNSGGPLVNLDGDVVGVNSLRVTEGISFAIPSDRVRP
FLEEYHKRQLTGKARMVFSNKKYLGLQMLPLTMPLSKELKIHYPDFPDVSSGVYVCKVVE
GTAAQSSGLRDHDVIVKINGKPITTTTDVLEALDSDSLSMAVLRGKDNLLLTVIPEVIN
Download sequence
Identical sequences ENSMMUP00000007924 9544.ENSMMUP00000007924 ENSMMUP00000007924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]