SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008000 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008000
Domain Number 1 Region: 91-198
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000631
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 2 Region: 512-565,616-647
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000235
Family Second domain of FERM 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008000
Domain Number - Region: 400-473
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000112
Family Ras-binding domain, RBD 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008000   Gene: ENSMMUG00000006086   Transcript: ENSMMUT00000008512
Sequence length 787
Comment pep:known chromosome:MMUL_1:16:52790661:52799328:-1 gene:ENSMMUG00000006086 transcript:ENSMMUT00000008512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPGGLWWLLCCRRGFTLLHRDYGDGELSGDGDEDEDEETFELRTPSPAGGGRGPLEVT
LTQPVRSGPVSNRLQSWEETWSLIPEKGLPEDDPDIVVKGWLYREPRGGGARPWLPPRRA
WFVLTRDSLDQFSSSGKGARRLGSLVLTSLCSVTGPERRRKETGLWSVTVSGRKHSVSLC
SPRQAEAERWGVALREVIASKAPLETPTQLLLRDIQESCGDPEAVALIYLRNPILRHTSG
ALYAPLLPLPYGVSAPGPGYAPLREEAVRLFLALQALEGARRPGPLMQGVLQTCRDLPAL
RDELFLQLAKQTSGPAGPPGLPATQDPATLRYWQLLTCMSCTFRPGGAVRGHLLGHLERT
EQALPDSELAEYARFIRKALGRTRGRELVPSLAEISALSQRQELLCTVHCPGAGACTVAI
DSHTTAGEVARELVGRLGLARSRNAFALYEQRGTQERALAGGTLVADVLTRFEKSVAKRT
LSSACPWHCAVVFADLLRFREAFSPDAGCLPQAHALLLRGWPPPPDDTLRALAALRLQSL
HRDFSPRVPLPRLDRLLPPPAPPREDPPRPTPRPPPSAALLAGALWSPGLAKRRAERARR
GGAGRMAGSMAREGGGGAGTAAAVLGGWKRLRGMGRAEAMAAYLALAAQCPGFGAARYDV
LELSTEPGGGAPQKLCLGLGAKAMSLSRPGETEPIHSVSYGHVAACQLMGPHTLALRVGE
SQLLLQSPQVEEIMQLVNAYLANPSPERPCSSSSRPCQDLPDTSPPSQHPGLDEPQGQSG
CLGQLQD
Download sequence
Identical sequences ENSMMUP00000008000 ENSMMUP00000008000 9544.ENSMMUP00000008000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]