SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008302 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008302
Domain Number 1 Region: 548-916
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.02e-134
Family Hect, E3 ligase catalytic domain 0.000000000000522
Further Details:      
 
Domain Number 2 Region: 18-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-17
Family PLC-like (P variant) 0.00031
Further Details:      
 
Domain Number 3 Region: 449-491
Classification Level Classification E-value
Superfamily WW domain 0.000000000000011
Family WW domain 0.00047
Further Details:      
 
Domain Number 4 Region: 382-415
Classification Level Classification E-value
Superfamily WW domain 0.000000000000193
Family WW domain 0.0012
Further Details:      
 
Domain Number 5 Region: 347-381
Classification Level Classification E-value
Superfamily WW domain 0.00000000000122
Family WW domain 0.0016
Further Details:      
 
Domain Number 6 Region: 493-528
Classification Level Classification E-value
Superfamily WW domain 0.00000000000924
Family WW domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008302   Gene: ENSMMUG00000006305   Transcript: ENSMMUT00000008832
Sequence length 922
Comment pep:known chromosome:MMUL_1:8:88952874:89044468:1 gene:ENSMMUG00000006305 transcript:ENSMMUT00000008832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATASPRSDTSNNHGGRLQLQVTVSSAKLKRKKNWFATAIYTEVAVDGEITKTAKSSSSS
NPKWDEQLTVNVTPQTTLEFRVWSRHALKADALLGKATIDLKEALLIHNRKLERVKEQLK
LSLENKNGIAQTGELTVVLDGLVIEQENITNCSSSPTIEIQQNGDALHENGEPSARTTAR
LAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLTSEPADD
TVNGESSSFAPTDNASVTGTPVVSEENALSPNCTSTTVEDPPVQEILTSSENNECIPSTS
AELGSEARSILEPDTSNSRSSSAFEAAKSRQPDGCVDPVRQQSGNANAETLPSGWEQRKD
PHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTTTWQRPTMESVRNF
EQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRVYFVNHNTK
TTQWEDPRTQGLQNEEPLPEGWEIRYTREGVRYFVDHNTRTTTFKDPRNGKSSVTKGGPQ
IAYERSFRWKLAHFRYLCQSNALPSHVKINVSRQTLFEDSFQQIMALKPYDLRRRLYVIF
RGEEGLDYGGLAREWFFLLSHEVLNPMYCLFEYAGKNNYCLQINPASTINPDHLSYFCFI
GRFIAMALFHGKFIDTGFSLPFYKRMLSKKLTIKDLESIDTEFYNSLIWIRDNNIEECGL
EMYFSVDMEILGKVTSHDLKLGGSNILVTEENKDEYIGLMTEWRFSRGVQEQTKAFLDGF
NEVVPLQWLQYFDEKELEVMLCGMQEVDLADWQRNTVYRHYTRNSKQIIWFWQFVKETDN
EVRMRLLQFVTGTCRLPLGGFAELMGSNGPQKFCIEKVGKDTWLPRSHTCFNRLDLPPYK
SYEQLKEKLLFAIEETEGFGQE
Download sequence
Identical sequences A0A2K5TM93 F7HIU5
NP_001247726.1.72884 XP_005563705.1.63531 9544.ENSMMUP00000008302 ENSMMUP00000008302 ENSMMUP00000008302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]