SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008559 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008559
Domain Number 1 Region: 28-237
Classification Level Classification E-value
Superfamily L domain-like 1.3e-41
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Domain Number 2 Region: 265-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000719
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 307-396
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000764
Family Fibronectin type III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008559   Gene: ENSMMUG00000006500   Transcript: ENSMMUT00000009110
Sequence length 531
Comment pep:known chromosome:MMUL_1:20:4530769:4533285:1 gene:ENSMMUG00000006500 transcript:ENSMMUT00000009110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSRVPLLLPLLLLLALRPGVQGCPSGCQCSQPQTVFCTARQGTTVPRDVPPNTVGLYVF
ENGITTLDTGSFAGLPSLQLLDLSQNQIASLPSGVFQPLANLSNLDLTANRLHEITNETF
HGLRRLERLYLGKNRIRHIQPGAFDTLDRLLELKLQDNELRALPPLRLPRLLLLDLSHNS
LLALEPGILDTANVEALRLAGLGLQQLDEGLFSRLRNHDLDVSDNQLERVPPLAPTWLSP
TEPATEAPSLPSTSPPTIGPVPQPQDCPPSTCLNGGTCHLEARHHLACLCPEGFTGLYCE
SQMGQGTQPSPTPATPRPPRPLTLGIEPVSPTSLRVGLQRYLQGSSVQLRSLRLTYRNLS
GPDKRLVTLRLPASLTEYTVTQLRPNATYSICVMPLGPGRVPEGDEACGEARTPPAVHSN
HAPVTQAREGNLPLLIAPALAAVFLAALAAVGTAYCVRRGRAVAAVAQDKGQVGPGAGPL
ELEGVKAPLEPGPKATEGGGEALPSGSECEVPLMGFPGPGLQSPLHAKPYI
Download sequence
Identical sequences ENSMMUP00000008559 ENSMMUP00000008559 9544.ENSMMUP00000008559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]