SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008640 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008640
Domain Number 1 Region: 40-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.89e-61
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000261
Further Details:      
 
Domain Number 2 Region: 385-501
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.87e-44
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008640   Gene: ENSMMUG00000006564   Transcript: ENSMMUT00000009195
Sequence length 509
Comment pep:known chromosome:MMUL_1:3:145299425:145329781:1 gene:ENSMMUG00000006564 transcript:ENSMMUT00000009195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQLIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCVEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
DKMMEQKSTAVKALTGGIAHLFKQNKVIHVNGYGKITGKNQVTATKVDGGTQVVDTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKSINF
Download sequence
Identical sequences A0A2K6DLG1 H9Z5Y2
9544.ENSMMUP00000008640 ENSMMUP00000008640 ENSMMUP00000008640 XP_005550565.1.63531 XP_011728724.1.29376 XP_014990158.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]