SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009115 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009115
Domain Number 1 Region: 311-370
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-18
Family Erythroid transcription factor GATA-1 0.00017
Further Details:      
 
Domain Number 2 Region: 257-309
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.76e-16
Family Erythroid transcription factor GATA-1 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009115   Gene: ENSMMUG00000006944   Transcript: ENSMMUT00000009704
Sequence length 444
Comment pep:known chromosome:MMUL_1:9:8255784:8276002:1 gene:ENSMMUG00000006944 transcript:ENSMMUT00000009704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLGHSYMDPAQYPLPEEVDVLFNIDGQGNHV
PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALSSHHAASPWNLSPFSKT
SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE
KECLKYQVPLPDSMKLESSHSRGSMTALGGPSSSAHHPITTYPPYVPEYSSGLFPPSSLL
GGSPTGFGCKSRPKARSSTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRP
LIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKE
GIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTP
TPMHPPSSLSFGPHHPSSMVTAMG
Download sequence
Identical sequences A0A2K5W1K4 A0A2K6E6E2 G7N1K1
ENSMMUP00000009115 ENSMMUP00000009115 9544.ENSMMUP00000009115 XP_001108337.1.72884 XP_005564657.1.63531 XP_005564658.1.63531 XP_011760970.1.29376 XP_011760971.1.29376 XP_011760972.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]