SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009134 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009134
Domain Number 1 Region: 1341-1652
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000842
Further Details:      
 
Domain Number 2 Region: 1617-1905
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.33e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000931
Further Details:      
 
Domain Number 3 Region: 323-517
Classification Level Classification E-value
Superfamily Fibronectin type III 3.44e-45
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 4 Region: 515-712
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-43
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 5 Region: 824-1016
Classification Level Classification E-value
Superfamily Fibronectin type III 2.12e-36
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 6 Region: 702-828
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-23
Family Fibronectin type III 0.00057
Further Details:      
 
Domain Number 7 Region: 22-116
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-18
Family I set domains 0.0041
Further Details:      
 
Domain Number 8 Region: 126-217
Classification Level Classification E-value
Superfamily Immunoglobulin 9.84e-17
Family I set domains 0.021
Further Details:      
 
Domain Number 9 Region: 235-329
Classification Level Classification E-value
Superfamily Immunoglobulin 2.75e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 10 Region: 1024-1146,1206-1252
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000389
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009134   Gene: ENSMMUG00000006952   Transcript: ENSMMUT00000009724
Sequence length 1913
Comment pep:known chromosome:MMUL_1:15:68408359:68827407:1 gene:ENSMMUG00000006952 transcript:ENSMMUT00000009724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHVARLLLLLLTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKK
GKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQ
IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRS
GRVFKRLNRRALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVETPQVRRVPPRFS
IPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSAN
YTCVAMSTLGVIEAIAQITVKALPKPPGTPIVTESTATSITLTWDSGNPEPVSYYIIQHK
PKNSEEPYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSS
APRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTI
GNLVPQKTYSVKVLAFTSIGDGPLSGDIQVITQTGVPGQPLNFKAEPESETSILLSWTPP
RSDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAE
ISARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDEKP
HEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTDEDVPSGPPRKVE
VEAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDD
TTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTA
LIQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARN
KVGFGEEMVKEISIPEEVPTGFPQNLHSESATSTSVQLSWQPPVLAERNGIITKYTLLYR
DINIPLLPMEQLIVPADITMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQV
FAKNFHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEK
SYSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKG
YYIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVL
PTEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQP
ITDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNSKEIPSHHPTDPV
ELRRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEV
NKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDF
WRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFA
LYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGR
TGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE
VPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIM
PYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTI
VVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRT
VRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSI
VLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHYAT
Download sequence
Identical sequences ENSMMUP00000009134 ENSMMUP00000009139 ENSMMUP00000039230 9544.ENSMMUP00000039230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]