SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009135 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009135
Domain Number 1 Region: 12-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-44
Family Galectin (animal S-lectin) 0.00011
Further Details:      
 
Domain Number 2 Region: 221-356
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.36e-41
Family Galectin (animal S-lectin) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009135   Gene: ENSMMUG00000015132   Transcript: ENSMMUT00000009725
Sequence length 358
Comment pep:known chromosome:MMUL_1:1:220488019:220507121:-1 gene:ENSMMUG00000015132 transcript:ENSMMUT00000009725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLSLNNLQNIIYNPVIPYVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQYGSSVKPRA
DVAFHFNPRFKRAGCIVCNTLIKEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNG
KHTLLYGHRIGTEKIDTLGIYGKVNIHSIGFRFSSDLQSTQASGLELTEISREKVPKSGT
PQLPSNRGDISKIVPRTVYTKSKDSTVNHSLTCTKIPPMNYVSKSLPFAARLNTPMGPGR
TVVVKGEVNTNAKSFNVDLLAGKSKDIALHLNPRLNIKAFIRNSFLQESWGEEERNITSF
PFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLVEVRSW
Download sequence
Identical sequences A0A096NCJ2 F6UL45
ENSMMUP00000019833 XP_014981995.1.72884 XP_014981999.1.72884 ENSMMUP00000009135 9544.ENSMMUP00000019833 ENSPANP00000010539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]