SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009376 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009376
Domain Number 1 Region: 30-75
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000011
Family LIM domain 0.00018
Further Details:      
 
Domain Number 2 Region: 2-29
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000135
Family LIM domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009376   Gene: ENSMMUG00000007158   Transcript: ENSMMUT00000009990
Sequence length 77
Comment pep:known chromosome:MMUL_1:7:168851431:168852993:1 gene:ENSMMUG00000007158 transcript:ENSMMUT00000009990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAM
FGPKGFGRGGAESHTFK
Download sequence
Identical sequences A0A096NK84 A0A0D9RAI2 A0A1D8BBG5 A0A1S2ZF68 A0A212CRX5 A0A287B781 A0A2J8SYZ4 A0A2K5E4V2 A0A2K5MFL1 A0A2K5RBI0 A0A2K5X3G2 A0A2K6DLZ8 A0A2K6MM00 A0A2K6QW17 F7DI11 H2RBE5 P50238
ENSMMUP00000009376 ENSPCAP00000009789 NP_001253775.1.72884 NP_001302.1.87134 NP_001302.1.92137 XP_004376821.1.4749 XP_005562474.1.63531 XP_005966804.1.78601 XP_005979169.1.78601 XP_007518435.1.11023 XP_007986250.1.81039 XP_010375206.1.97406 XP_011753373.1.29376 XP_011939610.1.92194 XP_012326540.1.9421 XP_014945981.1.54773 XP_016782366.1.37143 XP_017360939.1.71028 XP_017708311.1.44346 XP_020753362.1.74333 XP_020937309.1.46622 ENSMMUP00000009376 gi|4503047|ref|NP_001302.1| ENSP00000332449 ENSP00000376315 ENSP00000386340 ENSP00000455329 ENSP00000473914 ENSP00000474287 ENSP00000474410 ENSP00000474660 ENSP00000332449 ENSP00000454458 ENSPCAP00000009789 9544.ENSMMUP00000009376 9606.ENSP00000332449 ENSP00000332449 ENSP00000376315 ENSP00000386340 ENSP00000455329 ENSPANP00000013389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]