SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009552 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009552
Domain Number 1 Region: 36-219,286-362
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.98e-66
Family Crotonase-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009552   Gene: ENSMMUG00000007283   Transcript: ENSMMUT00000010179
Sequence length 386
Comment pep:known chromosome:MMUL_1:12:53894868:54013013:-1 gene:ENSMMUG00000007283 transcript:ENSMMUT00000010179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQREVWRLMSRFNAFKRTNTILHHLRMSKHTDAAEDVLLEKKGCAGVITLNRPKFLNAL
TLNMIRQIYSQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQNIAPVFFRE
EYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENI
ASVLENYHTESKIDRDKSFMLEEHMDKINSCFSANTMEEIIENLKQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWK
PADLKEVTDEDLNNHFKSLGSNDLKF
Download sequence
Identical sequences A0A1D5RL20 I7G8D4
ENSMMUP00000009546 ENSMMUP00000009552 NP_001272281.1.63531 XP_014966037.1.72884 9544.ENSMMUP00000009546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]