SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000009698 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000009698
Domain Number 1 Region: 35-145
Classification Level Classification E-value
Superfamily Fibronectin type III 3.17e-21
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 2 Region: 121-225
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-16
Family Fibronectin type III 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000009698   Gene: ENSMMUG00000007390   Transcript: ENSMMUT00000010336
Sequence length 311
Comment pep:known chromosome:MMUL_1:2:150801663:150844764:-1 gene:ENSMMUG00000007390 transcript:ENSMMUT00000010336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTFTMVLQEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVTVP
GETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLSSQ
TSAWSILKHPFNRNSTILTPPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAKEHV
KMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAF
VGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
SPEELLRAWIS
Download sequence
Identical sequences 9544.ENSMMUP00000009698 ENSMMUP00000009698 ENSMMUP00000009698 NP_001181587.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]