SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010217 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010217
Domain Number 1 Region: 99-197,232-476,575-641
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.66e-30
Family Glycerol-3-phosphate transporter 0.063
Further Details:      
 
Domain Number 2 Region: 498-547
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000283
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010217   Gene: ENSMMUG00000007773   Transcript: ENSMMUT00000010890
Sequence length 704
Comment pep:known chromosome:MMUL_1:6:98479695:98547185:-1 gene:ENSMMUG00000007773 transcript:ENSMMUT00000010890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSAKGIDNLAFVPSSPDILRRLSALPSEIEISAFSSDPQKENSQTQELQKPQEPQKSPE
PSLPSAPPNVSEEQLRSLSLSEFEEGPCGWRNFHPQCLQRFNTPRGFLLHYCLLAVTQGI
VVNGLVNISISTIEKRYEMKSSLTGLISSSYDISFCLLSLFVSFFGERGHKPRWLAFAAF
MIGLGALVFSLPQFFSGKYKMGSLFKDTCVTASNSTSCTSSTSSLSNYLYVFILGQLLLG
AGGTPLYTLGTAFLDDSVPTHKSSLYIGTGYAMSILGPAIGYVLGGQLLTMYIDAAYFPH
TDVTEDDPRWLGAWWIGFLLSWIFAWSLIIPFSCFPKHLPGTAEIQAGKTSQAHQSNGNA
DAKFGKTIKDFPAALKNLMKNAVFMCLVLSTSSEALITTGFATFLPKFIENQFGLTSSFA
ATLGGAVLIPGAALGQILGGFLVSKFKMTCKNTMKFALFTSGVAFTLSFVFIYANCENEP
FAGVSESYNGTGELGSLIAPCNANCNCLRSYYYPVCGDGVQYFSPCFAGCSNTVSHRKPK
VYYNCSCIERKTEITSTAETLGFEAKAGKCETHCANLPIFLCIFFIIIIFTFMASTPITV
SILRCVNHRQRSLALGIQFMFLRLLGTIPGPIIFGFTIDSTCILWDINDCGIKGACWIYD
NIKMAHMLVAISVTCKVITMFFNGFAILLYRPPPPATDVSFHNE
Download sequence
Identical sequences ENSMMUP00000034262 ENSMMUP00000010217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]