SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010624 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010624
Domain Number 1 Region: 871-1240
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.02e-128
Family Hect, E3 ligase catalytic domain 0.0000000038
Further Details:      
 
Domain Number 2 Region: 816-856
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000417
Family WW domain 0.00012
Further Details:      
 
Domain Number 3 Region: 529-572
Classification Level Classification E-value
Superfamily WW domain 0.000000000000278
Family WW domain 0.0011
Further Details:      
 
Domain Number 4 Region: 689-729
Classification Level Classification E-value
Superfamily WW domain 0.000000000000709
Family WW domain 0.0018
Further Details:      
 
Domain Number 5 Region: 768-802
Classification Level Classification E-value
Superfamily WW domain 0.00000000000419
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010624   Gene: ENSMMUG00000008112   Transcript: ENSMMUT00000011336
Sequence length 1247
Comment pep:known chromosome:MMUL_1:7:34147332:34238757:-1 gene:ENSMMUG00000008112 transcript:ENSMMUT00000011336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQSLRLHFAARRSNTYPLSETSGDDLDSHVHMCFKRPTRISASNVVQMKLTPRQTALAP
LIKENVRSQERSSVPSSENVNKKSSCLQISLQPTRYSGYLQSSNVLADSEDASFTCILKD
GIYSSAVVDSELNAVNDGNLVSSPAICSGSLSNFSTSDNGSYSSNGSDFGSCASITSGGS
YTNSVISDSSSYTLPPSDDTFLGGNLPSDSTSSGIVPNRNTTPCEIFSRSTSTDPFVQDD
LEHGLEIMKLPVSRNTKIPLKRCSSLVIFPRSPSNTPPTSPTSPCTLLSKGSYQTSHQFI
ISPSEIAHNEDGTGAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNT
PKQTVCEKSSEGYSCVSVHFTQQKTTTLDCETTNGDCKPEMSEIKLNSDSEYIKLTHRTS
ACLPSSQNVDYQININGELERPNSQMNKNHGILQRSISLGGAYPNISCLSSLKHNCSKGG
PSQLLIKFASGNEGKVDNLSRDSNRDCTNELSNSCKPGWVVLDQPDAACHLQQQQEPSPL
PPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQAQRAFTTRRQISEE
TESVDNRESSENWEIIREDEATMYSSQAFPSPPPSSNLDVPTHLAEELNARLTIFGNSAT
SQSASSSNHSSRRGSLQAYTFEEQPALPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRT
TTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSSQQVTQPSEIEQGFLPKGWEVRHAP
NGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSSDLGPLPPGWEERTHTDGRIFYIN
HNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKFEMKLRRATVL
EDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYYGLFEYSAT
DNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMMLHKPITLHD
MESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVTNKNKKEYI
YLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVNDWREHTK
YKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQSFTVE
QWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
Download sequence
Identical sequences 9544.ENSMMUP00000010624 ENSMMUP00000010624 ENSMMUP00000010624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]