SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010839 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010839
Domain Number 1 Region: 28-129,180-305,336-456,556-666
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.7e-35
Family LacY-like proton/sugar symporter 0.089
Further Details:      
 
Domain Number 2 Region: 467-523
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000018
Family Ovomucoid domain III-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010839   Gene: ENSMMUG00000008271   Transcript: ENSMMUT00000011561
Sequence length 712
Comment pep:known chromosome:MMUL_1:11:21119784:21176746:1 gene:ENSMMUG00000008271 transcript:ENSMMUT00000011561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSSKENIQLFCKTSVQPVGRPSFKTEYPSSEEKQPCCGELKVFLGALSFVYFAKALAE
GYLKSTITQIERRFDIPSSLVGVIDGSFEIGNLLVITFVSYFGAKLHRPKIIGAGCLIMG
VGTLLIAMPQFFMEQYKYEIYSPSSNSTLSISPCLLESSSQLPVSVMEKSKSKISNECEV
DTSSSMWIYVFLGNLLRGIGETPIQPLGIAYLDDFASEDNAAFYIGCVQTVAIIGPIFGF
LLGSLCAKLYVDIGFVNLDHITITPKDPQWVGAWWLGYLIAGIISLLAAVPFWYLPKSLP
RSQSREDSNSSSEKSKFIRDDHTDYQTPQGENVKIMEMARDFLPSLKNLFGNPVYFLYLC
TSTVQFNSLFGMVTYKPKYIEQQYGQSSSRANFVIGLINIPAVALGIFSGGIAMKKFRIS
VCGAAKLYLGSSVFGYLLFLSLFALGCENSDVAGLTVSYQGTKPVSYHERALFSDCNSRC
KCSETKWEPMCGENGITYVSACLAGCQTSNRSGKNIIFYNCTCVGIAASKSGNSSGIVGR
CQKDNGCPQMFLYFLVISVITSYTLSLGGIPGYILLLRCIKPQLKSFALGIYTLSIRVLA
GIPAPVYFGVLIDTSCLKWGFKRCGSRGSCRLYDSNVFRHIYLGLTVILGTVSIFLSIAV
LFILKKNYVSKHRNFITKRERTMVSTRFQKENCTTSDHLLQPKYWPGKETQL
Download sequence
Identical sequences ENSMMUP00000010839 9544.ENSMMUP00000010839 ENSMMUP00000010839 XP_011739019.1.29376 XP_015006730.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]