SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010898 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010898
Domain Number 1 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-24
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 319-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.56e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-22
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 5 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-19
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 532-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.83e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 8 Region: 130-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000709
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010898   Gene: ENSMMUG00000008313   Transcript: ENSMMUT00000011625
Sequence length 634
Comment pep:known chromosome:MMUL_1:19:41437655:41444494:-1 gene:ENSMMUG00000008313 transcript:ENSMMUT00000011625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAALRDPAQGCVTFEDVTIYFSQEEWGLLDEAQRLLYCDVMLENFALIASLGLISFRS
HIVSQLEMGKEPWVPDSVDMTSAMARGAYGRPGSDFCRRTEGKDLPSEHNVSVEGVAQDR
SPEATLCLQKTCPYDICGLHLKDILHLAEHQTTHPRQKPFPCEAYVKGSEFSANLPQRQV
QQNVHNPIRREEDQALPVKTWGDHTSDQLSTCREGGEDFVATAGFLQREFTPSDGEPHKA
TESMVDFHIALRHNKCCDSGDAFSDKSTLVQHQRIHSRERPYECSKCGIFFTYAADLTQH
QKVHNRGKPYECCECGKFFSQHSSLVKHRRVHTGESPHVCGDCGKFFSRSSNLIQHKRVH
TGEKPYECSDCGKFFSQRSNLIHHKRVHTGRSAHECSECGKSFNCNSSLIKHWRVHTGER
PYKCNECGKFFSHIASLIQHQIVHTGERPHGCSECGKAFSRSSDLMKHQRVHTGERPYEC
SECGKLFSQSSSLNSHRRLHTGERPYQCSECGKFFNQSSSLHNHRRLHTGERPYECSECG
KTFRQRSNLRQHLKVHKPDRPYECSECGKAFNQRPTLIRHQKIHTRERSMENVLLPCSMQ
QHTPEISSENRPYEGAVNYKLNFVHPSTHPGEVP
Download sequence
Identical sequences F7H6S3
9544.ENSMMUP00000010898 ENSMMUP00000010898 ENSMMUP00000010898 XP_001092908.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]