SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011032 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011032
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.87e-18
Family Glutathione peroxidase-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011032   Gene: ENSMMUG00000008414   Transcript: ENSMMUT00000011764
Sequence length 156
Comment pep:known chromosome:MMUL_1:15:96967407:96976920:1 gene:ENSMMUG00000008414 transcript:ENSMMUT00000011764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDILGGRHLVTRKGAAVEAEAALQNKVVALYFAAARCGPSRDFTQLLCDFYTALVAEAR
RPAPFEVVFVSADDSSQEMLNFMRELHGTWLALPFHDPYQHELRKRYNVTAIPKLVIVKQ
NGEVITNKGRKQIRERGLACFQDWVEAADIFQNFCG
Download sequence
Identical sequences ENSMMUP00000011032 XP_001087032.1.72884 ENSMMUP00000011032 9544.ENSMMUP00000011032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]