SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011198 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011198
Domain Number 1 Region: 17-274
Classification Level Classification E-value
Superfamily HemD-like 3.79e-69
Family HemD-like 0.000000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011198   Gene: ENSMMUG00000008539   Transcript: ENSMMUT00000011939
Sequence length 281
Comment pep:known chromosome:MMUL_1:9:125369476:125408917:-1 gene:ENSMMUG00000008539 transcript:ENSMMUT00000011939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPCSVTAPYKDCQAIMKVLLLKDAKEDDCGQDPYIRELGLYGLEATLIPVLSFEFLSLP
SFSEKLSHPEDYGGLIFTSPRAVEAAQLCLEKNNKTEVWERSLKEKWNAKSVYVVGNATA
SLVSKIGLDTEGETCGNAEKLAEYICSRESSALPLLFPCGNLKREILPKALKDKGIAMES
VTVYQTIPHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLKHIQELSGDNIDQIKFAAI
GPTTARALAAQGLPVSCTAESPTPQALATGIRKALQPHGCC
Download sequence
Identical sequences A0A2K5VG84
9544.ENSMMUP00000011197 XP_005566768.1.63531 XP_011720658.1.29376 XP_015003915.1.72884 ENSMMUP00000011197 ENSMMUP00000011198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]