SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011225 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011225
Domain Number 1 Region: 24-184
Classification Level Classification E-value
Superfamily Lipocalins 5.02e-20
Family Retinol binding protein-like 0.0065
Further Details:      
 
Domain Number 2 Region: 213-272
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00012
Further Details:      
 
Domain Number 3 Region: 275-327
Classification Level Classification E-value
Superfamily BPTI-like 3.26e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011225   Gene: ENSMMUG00000008559   Transcript: ENSMMUT00000011967
Sequence length 341
Comment pep:known chromosome:MMUL_1:15:22051419:22069284:1 gene:ENSMMUG00000008559 transcript:ENSMMUT00000011967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLGALLLLLSACLVVSAGPVPTPPDNIQVQENFNVSRIYGKWYNLAIGSTCPWLKKIM
DRMTVSTLVLGEGTTEAEISMTSTRWRKGVCEEMSGAYEKTDTDGKFLYHKSSKWSGRHA
HSLLCLKYLDVLSSPCLCNRSSHLAEMETLLQDFRVVAQGVGIPEDSIFTMADRGECVPG
EQEPEPILIPRARRAVLPQEEEGSGGGRLVTDVTKKEDSCQLGHSAGPCMGMTSRYFYNG
TSMACETFQYGGCMGNGNNFMTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGK
CVLFTYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
Download sequence
Identical sequences ENSMMUP00000011225 9544.ENSMMUP00000011225 ENSMMUP00000011225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]