SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011258 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011258
Domain Number 1 Region: 16-114,163-291,319-439,539-644
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.89e-36
Family Glycerol-3-phosphate transporter 0.068
Further Details:      
 
Domain Number 2 Region: 457-506
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000305
Family Ovomucoid domain III-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011258   Gene: ENSMMUG00000008583   Transcript: ENSMMUT00000012001
Sequence length 691
Comment pep:known chromosome:MMUL_1:11:21501438:21596104:1 gene:ENSMMUG00000008583 transcript:ENSMMUT00000012001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNKHLDKTAEAQSSENKKTRHCNGLKMFLAALALSFIAKALGAVVMKSSIIHIERRFE
ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
YRYSKEINIDSSENSTSTLSTCLINQIVSLNRTSPEIVGKGCVKESGSYMWMYVFMGNML
RGIGETPIVPLGLSYMDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGSV
DLSTVRITPNDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLPVLE
TNDGKSQTANLTSRGKKITKNVTGFFRSFKSILTNPLYVVFVLLTLLQISSYIGGFTYVF
KYVEQEYGQPSSKTNVLLGIVTLPIFASGMFLGGYIIKKFKLNPIGIAKFSFFTTVMSLF
FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
YISPCLAGCKSSSGNKKSIVFHNCSCLEVTGLQNRNYSAHLGECPRSDACLTKFYFFVAI
QVLNLFFSALGGTSYFMLMVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCM
KWSTNNCGTRGSCRIYNSTLFSKVYLGLSSVLRVSSLVLYIILIYAMKKKFQEKDANASE
NGSVMDEANLESLNNNKHFVPSAGADSETHY
Download sequence
Identical sequences F6UHW9
9544.ENSMMUP00000011258 ENSMMUP00000011258 ENSMMUP00000011258 XP_001097704.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]