SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011261 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011261
Domain Number 1 Region: 16-110,161-421,526-585
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.62e-35
Family LacY-like proton/sugar symporter 0.062
Further Details:      
 
Domain Number 2 Region: 445-497
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000122
Family Ovomucoid domain III-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011261   Gene: ENSMMUG00000008584   Transcript: ENSMMUT00000012006
Sequence length 681
Comment pep:known chromosome:MMUL_1:11:21629584:21690352:-1 gene:ENSMMUG00000008584 transcript:ENSMMUT00000012006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS
VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
SYIEDFAKSENSPLYIGLIETGAIIGPLIGLLLASFCANVYVDTGSVNTDDLTITPTDTR
WVGAWWFGFLICAGVNVLTAIPFFFLPKTLPKEGLENNADIIKNENEDKQREEDKKEKYG
ITKGKYTYFKYYEIDLLFHVDILSCNPIYMLFILISVIQFNAFVNMISFMPKYIEQQYGK
SSSDAIFLIGIYNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLHFLSFLVT
CENSSVVGINTSYEGIPQDLYMGNNVFANCNVDCNCPSKIWDPVCGNNGLSYLSACLAGC
ETSIGMGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSMMLQYFLILSAMSSFIYSLAAI
PGYMVLLRCMKSEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGAC
RIYDSTTFRYIYLGLPAALRGSSFVPALIILILLRKYHLPGENASSGTELTETKVKGKKN
ECKDMYQKSTVLNDDELKTKL
Download sequence
Identical sequences G7N6H3
9544.ENSMMUP00000011261 ENSMMUP00000011261 ENSMMUP00000011261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]