SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011505 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011505
Domain Number 1 Region: 130-224,267-377,413-519
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.09e-36
Family LacY-like proton/sugar symporter 0.034
Further Details:      
 
Domain Number 2 Region: 547-601
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000136
Family Ovomucoid domain III-like 0.008
Further Details:      
 
Domain Number 3 Region: 644-758
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0000051
Family LacY-like proton/sugar symporter 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011505   Gene: ENSMMUG00000008783   Transcript: ENSMMUT00000012266
Sequence length 846
Comment pep:known chromosome:MMUL_1:8:72250997:72405542:-1 gene:ENSMMUG00000008783 transcript:ENSMMUT00000012266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGTGLQPGPGEQLEAPATTGAVQERCEPETFRSKSLPVLSSASCRPILSPTNEDAKPA
FGCADSSGHEDLKQGPNQLAPSPSAPSTSAGLGDCNHRVDLSKTFSVSSALATLQERRCL
YVVLTDSRCFLVCMCFLTFIQALMVSGYLSSVITTIERRYSLKSSESGLLVSCFDIGNLV
VVVFVSYFGGRGRRPLWLAVGGLLIAFGAALFALPHFISPPYQIQELNASAPNDGLCQGG
NSTATLEPPACPKDSGGNNHWVYVALFICAQILIGMGSTPIYTLGPTYLDDNVKKENSSL
YLAIMYVMGALGPAVGYLLGGLLIGFYVDPRNPVHLDQNDPRFIGNWWSGFLLCAIAMFL
VIFPMFTFPKKLPPRHKKKKKFSVDAVSDDDVLKEKSNNSEQVDKKVSSMGFGKDVRDLP
RAAVRILSNMTFLFVSLSYTAESAIVTAFITFIPKFIESQFGIPASNASIYTGVIIVPSA
GVGIVLGGYIIKKLKLGARESAKLAMICSGVSLLCFSTLFIVGCESINLGGINIPYTTGP
SLTMPHRNLTGSCNVNCGCKIHEYEPVCGSDGITYFNPCLAGCVNSGNLSTGIRNYTECT
CVQSRQVITPPTVGQRSQLRVVIVKTYLNENGYAVSGKCKRTCNTLIPFLVFLFIVTFIT
ACAQPSAIIVTLRSVEDEERPFALGMQFVLLRTLAYIPTPIYFGAVIDTTCMLWQQECGV
QGSCWEYNVTSFRFVYFGLAAGLKFVGFIFIFLAWYSIKYKEDGLQRRRWREFPVSTVSE
RVGHPDSARTRSCPAFSTQGEFHEETGLQKGIQCAAQTYPGPFPEAISSSADPGLEESPA
ALEPPS
Download sequence
Identical sequences 9544.ENSMMUP00000011505 ENSMMUP00000011505 ENSMMUP00000011505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]