SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011860 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011860
Domain Number 1 Region: 126-205
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-20
Family SH3-domain 0.00000442
Further Details:      
 
Domain Number 2 Region: 809-888
Classification Level Classification E-value
Superfamily SH3-domain 9.84e-16
Family SH3-domain 0.001
Further Details:      
 
Domain Number 3 Region: 266-424
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000145
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 4 Region: 446-557
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000182
Family Fibronectin type III 0.00000212
Further Details:      
 
Domain Number 5 Region: 912-965
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000171
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011860   Gene: ENSMMUG00000009048   Transcript: ENSMMUT00000012647
Sequence length 965
Comment pep:known chromosome:MMUL_1:11:131672299:131722899:-1 gene:ENSMMUG00000009048 transcript:ENSMMUT00000012647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSKVRELEEKCRTQSEQFNLLSRDLEKFRQHAGKIDLLGGSTVAPLDVSTAPGKPFPQFV
NGLATSLGKGQESAIGGGSAIGEYIRPLPQPGDSPEPLSAKPTFLSRSGSPRCRSESDME
NERNSNTSKQRYSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYE
GELLDGQRGLVPSNFVDFVQDNESRLASTLGNEQDQNFINHSGIGLEGEHILDLHSPTHT
DAGITDNSAGTLDVNIDDIGEDIVPYPRKITLIKQLAKSVIVGWEPPAVPPGWGTVSSYN
VLVDKETRMNLSLGSRTKALIEKLNMAACTYRISVQCVTSRGSSDALQCTLLVGKDVVVA
PSHLRVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVK
VLAKPHQMPWQLPLEQREKKEAFVEFSTLPAGPPAPPQDVTVQAGATPATIRVSWRPPVL
TPSGLSNGANVTGYGVYAKGQRVSFPLKTPSLTAVELVRLRSLEAKGVTVRTLSAQGESV
DSAVAAVPPELLVPPTPHPRPTPQSKPLASSGVPDTKDERLGPHARMDEAWEQSRAPGPV
HGHTLEPPAGPGRRSPSPSRILPQPQGTPVSTTVAKAMAREAAQRVAESSRLEKRSVFLE
RSSAGQYAASDEEDAYDSPDFKRRGASVDDFLKGSELGKQPHCCHGDEYHTESSRGSDLS
DIMEEDEEELYSEMQLEDGGRRRPSGTSHNALKILGNPASAGRVDHMGRRFPRGSAGPQR
SRPVTVPSIDDYGRDRLSPDFYEESETDPGAEELPARIFVALFDYDPLTMSPNPDAAEEE
LPFKEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEIQADDEEMMDQLLRQGFLPLN
TPVEKIERSRRSGRHHSVSTRRMVALYDYDPRESSPNVDVEAELTFCTGDIITVFGEIDE
DGFYY
Download sequence
Identical sequences ENSMMUP00000011860 9544.ENSMMUP00000011860 ENSMMUP00000011860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]