SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011881 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011881
Domain Number 1 Region: 58-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.42e-37
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 295-361
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000023
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 506-612
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000154
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 710-782
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000617
Family VWC domain 0.022
Further Details:      
 
Domain Number 5 Region: 455-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000281
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 617-659
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 362-419
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000565
Family VWC domain 0.034
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011881
Domain Number - Region: 652-715
Classification Level Classification E-value
Superfamily FnI-like domain 0.00314
Family VWC domain 0.024
Further Details:      
 
Domain Number - Region: 420-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00489
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 793-830
Classification Level Classification E-value
Superfamily FnI-like domain 0.0091
Family VWC domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011881   Gene: ENSMMUG00000009055   Transcript: ENSMMUT00000012668
Sequence length 838
Comment pep:known chromosome:MMUL_1:14:50285497:51219630:-1 gene:ENSMMUG00000009055 transcript:ENSMMUT00000012668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDVILVVWFCVCTARTAGDMKPPVLSLMWSTRVLKSLLQQFLQGVVGFGMDPDLQMDI
ITELDLVNTTLGVAQVSGMHNASKAFLFQDIEREIHAAPHVSEKLIQLFRNKSEFTFLAT
VQQKPSTSGVILSIRELEHSYFELESSGLRDEIRYHYIHSGKPRTEALPYRMADGRWHKI
ALSVSASHLLLHVDCNRIYERVIDPPDTNLPPGINLWLGQRNQKHGLFKGIIQDGKIIFM
PNGYITQCPNLNRTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLSQLENCHCEKT
CQVSGLLYRDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCR
PKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGH
NFCAEGPKCGENSECKNWNTKATCECKSGYISVQGDSAYCEDIDECAAKMHYCHANTVCV
NLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQHNCDENAICTNTVQGHSCTCKPGYVGNG
TICRAFCEEGCRYGGTCVAPNKCVCPSGFTGSHCEKDIDECSEGIIECHNHSRCVNLPGW
YHCECRSGFHDDGTYSLSGESCIDIDECALRTHTCWNDSACINLAGGFDCLCPSGPSCSG
DCPHEGGLKRNGQVWTLKEDRCSVCSCKDGKIFCRRTACDCQNPSADLFCCPECDTRVTS
QCLDQNGHKLYRSGDNWTHSCQQCRCLEGEVDCWPLTCPNLSCEYTAILEGECCPRCVSD
PCLADNIAYDIRKTCLDSYGVSRLSGSVWTMAGSPCTTCKCKNGRVCCSVDLECLQNN
Download sequence
Identical sequences F6QSV0
ENSMMUP00000037035 9544.ENSMMUP00000037035 ENSMMUP00000011881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]