SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011963 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011963
Domain Number 1 Region: 171-367
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.66e-57
Family Prokaryotic proteases 0.000000623
Further Details:      
 
Domain Number 2 Region: 382-478
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family HtrA-like serine proteases 0.0029
Further Details:      
 
Domain Number 3 Region: 35-123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000691
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 4 Region: 111-156
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000191
Family Ovomucoid domain III-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011963   Gene: ENSMMUG00000009117   Transcript: ENSMMUT00000012757
Sequence length 481
Comment pep:known chromosome:MMUL_1:9:122078332:122131033:1 gene:ENSMMUG00000009117 transcript:ENSMMUT00000012757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIPRAALLPLLLLLLLAAPASAQLSRAGRSAPLATGCPERCEPARCPPQPEHCEGGRAR
DACGCCEVCGAPEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASNEPVC
GSDANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKI
APAVVHIELFRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKHRVKVELKNGATYE
AKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVST
TQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDK
IKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIP
DTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEID
P
Download sequence
Identical sequences H9FX91
ENSMMUP00000011963 NP_001245105.1.72884 9544.ENSMMUP00000011963 ENSMMUP00000011963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]