SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012327 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012327
Domain Number 1 Region: 15-201
Classification Level Classification E-value
Superfamily PR-1-like 4.32e-40
Family PR-1-like 0.00024
Further Details:      
 
Domain Number 2 Region: 301-445
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-26
Family C-type lectin domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012327   Gene: ENSMMUG00000009424   Transcript: ENSMMUT00000013154
Sequence length 455
Comment pep:known chromosome:MMUL_1:20:72446816:72448721:-1 gene:ENSMMUG00000009424 transcript:ENSMMUT00000013154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHSETSPGRGHLLAVLLAFLGTTWAEVWPPQLQEQAPMARALTRKESFLLLSLHNRLRS
WVQPPAADMRRLDWSDSLAQLAQARAALCGTPTPSLASAPWRTLQVGWNVQLLPAGSASF
VEVVSLWFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSADQAAIEAFVC
AYSPGGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCEVPRNPCRMSCQNHG
RLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREEECSCVCDVGYGGAQCATKVHFPFH
TCDLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIESQKVQDILAFYLGRLETTNEVT
DSDFETRNFWIGLTYKTAKDSFRWATGEHQAFTSFAFGQPDNQGLVWLRAAMGFGNCVEL
QASAAFNWNDQRCKTRNRYICQFAQEHISRWGPGS
Download sequence
Identical sequences F6RY13
ENSMMUP00000012327 ENSMMUP00000032322 9544.ENSMMUP00000032322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]