SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012524 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012524
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000039
Family SPRY domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012524   Gene: ENSMMUG00000009579   Transcript: ENSMMUT00000013368
Sequence length 123
Comment pep:known chromosome:MMUL_1:17:28728897:28742720:-1 gene:ENSMMUG00000009579 transcript:ENSMMUT00000013368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGIWGIGVATQKVNLNQIPLGRDVHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGIT
YDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQ
QIF
Download sequence
Identical sequences ENSMMUP00000012524 9544.ENSMMUP00000012524 ENSMMUP00000012524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]