SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012529 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012529
Domain Number 1 Region: 495-687
Classification Level Classification E-value
Superfamily Fibronectin type III 9.95e-49
Family Fibronectin type III 0.00000165
Further Details:      
 
Domain Number 2 Region: 813-1010
Classification Level Classification E-value
Superfamily Fibronectin type III 5e-35
Family Fibronectin type III 0.00000133
Further Details:      
 
Domain Number 3 Region: 207-301
Classification Level Classification E-value
Superfamily Immunoglobulin 7.32e-24
Family I set domains 0.0093
Further Details:      
 
Domain Number 4 Region: 298-394
Classification Level Classification E-value
Superfamily Immunoglobulin 9.37e-22
Family I set domains 0.0076
Further Details:      
 
Domain Number 5 Region: 391-491
Classification Level Classification E-value
Superfamily Fibronectin type III 2.18e-21
Family Fibronectin type III 0.00000129
Further Details:      
 
Domain Number 6 Region: 679-785
Classification Level Classification E-value
Superfamily Fibronectin type III 2.31e-19
Family Fibronectin type III 0.000000698
Further Details:      
 
Domain Number 7 Region: 98-196
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-17
Family I set domains 0.032
Further Details:      
 
Domain Number 8 Region: 12-115
Classification Level Classification E-value
Superfamily Immunoglobulin 2.04e-17
Family I set domains 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012529   Gene: ENSMMUG00000009584   Transcript: ENSMMUT00000013374
Sequence length 1418
Comment pep:known chromosome:MMUL_1:7:51808428:51993484:1 gene:ENSMMUG00000009584 transcript:ENSMMUT00000013374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GASIRTFTPFYFLVEPVDTLSVRGSSVILNCSAYSEPSPKIEWKKDGTFLNLASDDRRQL
LPDGSLFISNVVHSKHNKPDEGYYQCVATVESLGTIVSRTAKLTVAGLPRFTSQPEPSSV
YAGNSAILNCEVNADLVPFVRWEQNRHPLLLDDRVIKLPSGMLVISNATEGDGGLYRCIV
ESGGPPKYSDEVELKVLPDTEVTSDLVFLKQPSPLVRVIGQDVVLPCVASGLPTPTIKWM
KNEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEF
LKQPTNIYAHESMDIVFECEVTGKPTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKS
DEGFYQCIAENDVGNAQAGAQLIILEHAPATTGPLPSAPRDVVASLVSTRFIKLTWRTPA
SDPHGDNLTYSVFYTKEGIARERVENTSRPGEMQVTIQNLMPATVYVFRVMAQNKHGSGE
SSAPLRVETQPEVQLPGPAPNIRAYATSPTSITVTWETPVSGNGEIQNYKLYYMEKGTDK
EQDVDVSSHSFTINGLKKYTEYSFRVVAYNKHGPGVSTQDVAVRTLSDVPSAAPQNLSLE
VRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGT
EYNFRVAALTINGTGPATDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPEN
QNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYE
SAVTRPHTDTSEVDLFVINAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQ
KITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSM
TAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIH
DWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKADSSDKMPND
QASGSGGKGSRLPDLGSDYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVVVII
AVFCTRRTTSHQKKKRAACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNP
IMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDS
QPPQPVISAHPIHSLDHPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTESV
RNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFA
VPAVPPPGPPTYDPALPSTPLLSQQALNHHIHSVKTASIGTLGRSRPPMPVVVPSAPEVQ
ETTRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA
Download sequence
Identical sequences ENSMMUP00000012529 9544.ENSMMUP00000012529 ENSMMUP00000012529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]