SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012632 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012632
Domain Number 1 Region: 139-359
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.21e-59
Family Ankyrin repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 6-108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000779
Family Fibronectin type III 0.0000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012632   Gene: ENSMMUG00000009655   Transcript: ENSMMUT00000013483
Sequence length 371
Comment pep:known chromosome:MMUL_1:9:125477927:125598365:1 gene:ENSMMUG00000009655 transcript:ENSMMUT00000013483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPQKITPPSKPHPPVVGKVTHHSIELYWDLEKKAKRQGPQEQWFRFSIEEEDPKMHSYG
IIYTGYATKHVVEGLEPRTLYRFRLKVTSPSGECEYSPLVSVSTTRPSLSKNIVKIRMVT
SVLHGPPTENTGEPISSEHLHRAVNVNDEDLLVRILQGGHVKVDVPNKFGFTALMVAAQK
GYTRLVKILVSNGTDVNLKNGSGKDSLMLACYAGHLDVVKYLRRHGASWQARDLGGCTAL
HWAADGGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVK
DRNGKTPLMVAVLNNHEELVQLLLDKGADASVKNEFGKGVLEMARVFDRQSVISLLEERK
KKQRPKKSCVC
Download sequence
Identical sequences ENSMMUP00000012632 9544.ENSMMUP00000012632 ENSMMUP00000012632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]