SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013282 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013282
Domain Number 1 Region: 64-235
Classification Level Classification E-value
Superfamily Fibronectin type III 5.3e-18
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 2 Region: 234-401
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000019
Family Fibronectin type III 0.008
Further Details:      
 
Domain Number 3 Region: 403-478
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000107
Family Fibronectin type III 0.0048
Further Details:      
 
Domain Number 4 Region: 3-71
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000879
Family Fibronectin type III 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013282
Domain Number - Region: 493-565
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00424
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013282   Gene: ENSMMUG00000010156   Transcript: ENSMMUT00000014182
Sequence length 596
Comment pep:known chromosome:MMUL_1:1:111713499:111736735:1 gene:ENSMMUG00000010156 transcript:ENSMMUT00000014182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIGFSVSIMQANGLGSIWKENTTNTSLTFTSLEAGTLYTIKAYAWNANGIPGDDSTCNQ
RTSPRAPANIQVSFDSGALKASFSWALAEGAFNYTVMALSDSSELTCSTAFSSCTISSLQ
CGTEYLISVSASNDAGSSKSSSTVTLKTVACAPGRVTIQEDPPGHLSVAWSNVDLGDYYV
VFVKSDDGLEVHCNTSLTECNFLSECGFTYFISVFAYNKAGQSPLGDIFNYTTAPCCPSD
INPVLVSSDRVEIVWSPVRGAELYETKAADGYNTVECNDTVPACTLSALECDTKYNITVY
SFSEVRGSNMSCTPQFITTAPCSPEIKNVSRDAFSTINVHWQSTNDDATYTVTAQGEKGL
YQCSSMGESCTMRGLPCGSVFSVTAVAETQAGRSLPSYSVPLETVPCCPTGLTVTQITQS
VINVSWTIGRVAQTHVAVLESHTGQSKCHTHQNYCLLGCITCGVNYTVTLKAISATGLTA
DCSYQSYFSGACCPLGVKLYRLGSNGIRIYWQASRGSASYSTDLYGSKGIFTCTPSAGLS
FCDVTEIPCGDVYTVMVSPVAEAGLKLTFCPKKIYSVTCSGSTLGMVIYRGKRNEE
Download sequence
Identical sequences G7MIC4
ENSMMUP00000013282 9544.ENSMMUP00000013282 ENSMMUP00000013282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]