SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013371 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013371
Domain Number 1 Region: 111-282
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.72e-46
Family SPRY domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013371   Gene: ENSMMUG00000005206   Transcript: ENSMMUT00000014275
Sequence length 284
Comment pep:known scaffold:MMUL_1:1099214740704:7566:11159:-1 gene:ENSMMUG00000005206 transcript:ENSMMUT00000014275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDYVSLRIEAIRAEYQKMPAFLHEEEQHHLERLQKEGEDIFQQLNESKARMEHSRELLRG
MYEDLKQMCHKADVELLQAFEDILHRYESLLLQVPEPANPELSAGPITGLLDRLNGFRVD
FTLQPERANSHIFLYGDLRSMNVGCDPQDDPHITAKSECFLVWGAQTFTSGKYYWEVHVG
DSWNWAFGVCNNYWKEKRQNDKIDGEEGLFLLGCVKEDAHSSLFTTSPLVVQYVPRPTSR
VGLFLDCEGRTMTFVDVDQSSLIYTIPNCSFSPPLRPVFCCSHF
Download sequence
Identical sequences 9544.ENSMMUP00000013371 ENSMMUP00000013371 ENSMMUP00000013371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]