SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013403 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013403
Domain Number 1 Region: 19-153
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-35
Family Galectin (animal S-lectin) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013403   Gene: ENSMMUG00000010238   Transcript: ENSMMUT00000014312
Sequence length 154
Comment pep:known chromosome:MMUL_1:13:64666046:64672579:1 gene:ENSMMUG00000010238 transcript:ENSMMUT00000014312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNNSLGSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSED
PPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVF
VDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG
Download sequence
Identical sequences ENSMMUP00000013403 ENSMMUP00000013403 9544.ENSMMUP00000013403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]