SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013519 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013519
Domain Number 1 Region: 690-1016
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-90
Family Hect, E3 ligase catalytic domain 0.00000193
Further Details:      
 
Domain Number 2 Region: 81-350
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.96e-71
Family Regulator of chromosome condensation RCC1 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013519   Gene: ENSMMUG00000010316   Transcript: ENSMMUT00000014431
Sequence length 1020
Comment pep:known chromosome:MMUL_1:5:81423229:81473699:1 gene:ENSMMUG00000010316 transcript:ENSMMUT00000014431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRSRRKSRRDGRSTAGQTAASQPAKSPDAQLWLFPSAAGFYRALLRRAEVTRQICCSP
RRLAVLERGGAGVQVHQVLAGSGGARTPKCIKLGKNMKIHSVDQGADHMLILSSDGKPFE
YDYSMKHLRSESILQEKKIIQITCGDYHSLALSKGGELFAWGQNLHGQLGVGRKFPSTTT
PQIVEHLAGVPLAQISAGEAHSMALSMSGNIYSWGKNEFGQLGLGHTESKDSPSLIEALD
NQKVEFLACGGSHSALLTQDGLLFTFGAGKHGQLGHNSTQNELRPCLVAELVGNRVTQIA
CGRWHTLAYVSDFGKVFSFGSGKDGQLGNGGTLDQLIPLPVKVSSSEELKLESHTSEKEL
IMIAGGNQSILLWIKKENSYVNLKRTIPTLNEGTVKRWIADVETKRWHSTKREIQEIFSS
PACLTGSFLRKRRTTEMMPVYLDLNKARDIFKELTQKDWITNMVTTCLKDNLLKRLPFHS
PHQEALEVFFLLPECPVMHLSNNWESLVVPFAKVVCKMSDPSSLVLGKIDHLKILYLSGK
ICLVFKTARGRVRDQPDQHSETPSLQKIQKLASHILFKVNQMKCQLPESIFQVDELLYRL
NFFVEVCRRCLWKMTVDTSENAGCWVIFSHFPFIFNHLSKIKLLHTDTLLKIEHKSHAKC
LLNHAIFWGETNGCGIQGAYTLMKKARQTDVLNQLSQENEDLRKELWVSFSGEIGYDLVG
VKREFFYCLFEEMIQPEYGMFMYPEGASCMWFPVRPKFEKKRYFFFGLLCGLSLFNCNVA
NLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQTLLDDEGDNFEEVFYIHFNVHWDRND
TNLIPNGSSIIVNQTNKRDYVSKYIDYIFNDSVKAVYEEFRRGFYKMCDEDIIKLFHPEE
LKDVIVGHTDYDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDR
LQTKDLKNMKITFCCPESWNERDPMRALTCFSVLFLPKYSTMETVEEALQVAINNNRGFG
Download sequence
Identical sequences ENSMMUP00000013519 9544.ENSMMUP00000013519 ENSMMUP00000013519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]