SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013690 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013690
Domain Number 1 Region: 406-730
Classification Level Classification E-value
Superfamily DNase I-like 1.1e-58
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0001
Further Details:      
 
Domain Number 2 Region: 20-117
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-26
Family SH2 domain 0.00018
Further Details:      
 
Domain Number 3 Region: 1193-1256
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000314
Family SAM (sterile alpha motif) domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013690   Gene: ENSMMUG00000010451   Transcript: ENSMMUT00000014614
Sequence length 1258
Comment pep:known chromosome:MMUL_1:14:70298885:70299592:1 gene:ENSMMUG00000010451 transcript:ENSMMUT00000014614 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASACGAPGPGGALGSQAPSWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALCV
LYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLPVEGE
REPDPPDDRDASDGEDEKPPLPPRSGSTSISATTGPSSPLSVPETPTTPAAESAPNGLST
VSHEYLKGSYGLDLEAVRGGASHLPHLTRTLATSCRRLHSEVDKVLSGLEILSKVFDQQS
SPMVTRLLQQQNLPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDMSSTAPPAPQPS
TRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQEDWTTFT
HDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNKHSKQDE
PDMISIFIGTWNMGSVPPPKNVTSWFTSRGLGKTLDEVTVTIPHDIYVFGTQENSVGDRE
WLDLLRGGLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGIANTLGN
KGAVGVSFMFNGTSFGFVNCHLTSGNEKTARRNQNYLDILRLLSLGDRQLSAFDISLRFT
HLFWFGDLNYRLDMDIQEILNYISRKEFEPLLRVDQLNLEREKHKVFLRFSEEEISFPPT
YRYERGSRDTYAWHKQKPTGVRTNVPSWCDRILWKSYPETHIICNSYGCTDDIVTSDHSP
VFGTFEVGVTSQFISKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCLEEYKKS
FENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESYGECVVA
LKSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYEWISIDKDEAGAKS
KAPSVSRGIQEPRSGSRKPAFTEASCPLSRLFEEPEKPPPTGRPPAPPRAAPREEPLTPR
LKPEGTPEPEGVAAPPPKNSFNNPAYYVLEGVPHQLLPPEPPSPARAPVPPATKNKVAIT
VPAPQLGRHRPPRVGEGSSSDEESGGTLPPPDFPPPPLPDSAIFLSPSLDPLPGPVVRGR
GGGEARGPPPPKAHPRPPLPPGPSPASTFLGEVAGGDDRSCSVLQMAKTLSEVDYAPAGP
ARSALLPGPLELQPHRGLSSDYGRPLSFPPPRIRESIQEDLAEEAPCPQGGRASGLGEAG
MGAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Download sequence
Identical sequences H9Z8L9
ENSMMUP00000013695 NP_001247768.1.72884 ENSMMUP00000013690 9544.ENSMMUP00000013695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]