SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014004 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014004
Domain Number 1 Region: 569-657
Classification Level Classification E-value
Superfamily PH domain-like 9.83e-19
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 383-476
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 273-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000785
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 533-568
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000196
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014004
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00887
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014004   Gene: ENSMMUG00000010689   Transcript: ENSMMUT00000014946
Sequence length 680
Comment pep:known chromosome:MMUL_1:7:115880634:115972414:-1 gene:ENSMMUG00000010689 transcript:ENSMMUT00000014946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPRYLKKYKNKQITARIL
EAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDAST
GDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRA
KDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences A0A2I3HU03 A0A2J8WKS8 A0A2K5IY68 A0A2K5M7M6 A0A2K5Q0C0 A0A2K5WND2 A0A2K6A5B0 A0A2K6FDJ1 A0A2K6M1T9 A0A2K6P5M6 A7MB21 G1M9T8 I0FNS4 I3MBW2
ENSMMUP00000014004 ENSBTAP00000019278 ENSBTAP00000019278 ENSAMEP00000016111 ENSMMUP00000032902 9544.ENSMMUP00000032902 9913.ENSBTAP00000019278 NP_001094734.1.59421 NP_001094734.1.76553 NP_001253248.1.72884 XP_002919687.1.58354 XP_003267750.1.23891 XP_004415883.1.74151 XP_004738862.1.14098 XP_005338029.1.77405 XP_005561334.1.63531 XP_005899372.1.15283 XP_006199830.1.17985 XP_006872423.1.41390 XP_007984907.1.81039 XP_010370370.1.97406 XP_010846047.1.44457 XP_010960472.1.22495 XP_010981236.1.51371 XP_011817201.1.43180 XP_011855108.1.47321 XP_011917232.1.92194 XP_012519275.1.63892 XP_012613457.1.48125 XP_017203801.1.1745 XP_017367883.1.71028 XP_017704989.1.44346 XP_019581272.1.88060 XP_019824482.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]