SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014037 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014037
Domain Number 1 Region: 560-631
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000993
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 500-565
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000434
Family LIM domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014037   Gene: ENSMMUG00000010711   Transcript: ENSMMUT00000014982
Sequence length 674
Comment pep:known chromosome:MMUL_1:2:90856488:90937783:-1 gene:ENSMMUG00000010711 transcript:ENSMMUT00000014982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKYDDLGLEASKFIEDLNMYEASKDGLFRVDKGAGNNPEFEETRRVFATKMAKIHLQQQ
QQLLQEETLPRGSRGPVNGGGRLGPQTRREVGVGSKLTVDGAAKPPLAASTGSPGAVTTF
AAGQHPYPPQEQRSRPYLHGTRHGSQDCGSRESPATSEMSALHQPGPCEDPSCLTHGDYY
DNLSLASPKWGDKPGVSPSIGLSVGSGWPSSLGSDPPLPKPCGDHPLNQRQLSLNSSRSS
EGSLGGQDSGIGGRSSEKPTGLWSTASSQRVSPGLPSPNLENGAPALGPAQPRTPSVSAP
LALSCPRQGGLPRSNSGLGGEVSGVMSKPNVAPQAWFQDGPKSYLSSSAPSSSPAGLDSS
QPGAVPGLGPKPGCTDLGTGPKLSPTSLVHPVMSTLPELSCKEGTLGWSSDGSLGPVLLE
SPSSPRVRLPCQPLVPGPELRPSAAELKLEALTQRLEREMDAHPKADYFGDCLWGQPGVL
VCGTHCPCLCWHDPVLSVGSCGRKLRGKAFYFVNGKVFCEEDFLVSVLSHTSRSPYLCEP
RPLPWILQALGKSYHPGCFRCVVCNECLDGVPFTVDSENKIYCVRDYHKVLAPKCAACGL
PILPPEGSDETIRVVSMDRDYHVECYHCEDCGLELNDEDGHRCYPLEDHLFCHSCHVKRL
EKRPSSTALHQHHF
Download sequence
Identical sequences 9544.ENSMMUP00000014037 ENSMMUP00000014037 ENSMMUP00000014037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]