SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014569 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014569
Domain Number 1 Region: 508-709
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-23
Family SPRY domain 0.0057
Further Details:      
 
Domain Number 2 Region: 204-267
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.66e-16
Family B-box zinc-binding domain 0.00098
Further Details:      
 
Domain Number 3 Region: 431-511
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000365
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 4 Region: 25-64
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000783
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014569
Domain Number - Region: 149-199
Classification Level Classification E-value
Superfamily RING/U-box 0.0339
Family ZZ domain 0.039
Further Details:      
 
Domain Number - Region: 251-341
Classification Level Classification E-value
Superfamily Prefoldin 0.0366
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014569   Gene: ENSMMUG00000011130   Transcript: ENSMMUT00000015556
Sequence length 728
Comment pep:known chromosome:MMUL_1:6:111450645:111502901:-1 gene:ENSMMUG00000011130 transcript:ENSMMUT00000015556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESGEMSEFGYIMELLAKGKVTIKNIERELICPACKELFTHPLILPCQHSICHKCVKEL
LLTLDDSFNDVGSDNSNQSSPRLRLPSPSMDKIDRINRPGWKRNSLTPRTTIFPCPGCEH
DVDLGERGINGLFRNFTLETIVERYRQAARAATAIMCDLCKPPPQESTKSCMDCSASYCN
ECFKIHHPWGTIKAQHEYVGPTTNFRPKILMCPEHETERINMYCELCRRPVCHLCKLGGN
HANHRVTTMSSAYKTLKEKLSKDIDYLIGKESQVKSQISELNLLMKETECNGERAKEEAI
THFEKLFEILEERKSSVLKAIDSSKKLRLDKFQTQMEEYQGLLENNGLVGYAQEVLKETD
QSCFVQTAKQLHLRIQKATESLKSFRPAAQTSFEDYVVNTSKQTELLGELSFFSSGIDVP
EINEEQSKVYNNALINWHHPEKDKADSYVLEYRKINREDEMSWNEIEVCGTSKIIQDLEN
SSTYAFRVRAYKGSICSPCSRELILHTPPAPVFSFLFDEKCGYNNEHLLLNLKRDRVESR
AGFNLLLAAERIQVGYYTSLDYIIGDTGITKGKHFWAFRVEPYSYLVKVGVASSDKLQEW
LRSPRDAVSPRYEQDSGHDSGSEDACFDSSQPFTLVTIGMKKFFIPKSPTSSNEPENRVL
PMPTSIGIFLDYDKGKVSFYDMDHMKCLYERQVDCSHTLYPAFALMGSGGIQLEEPITAK
YLEYQEDM
Download sequence
Identical sequences A0A2K5LBZ0 F7CIJ0
NP_001253408.1.72884 XP_011771190.1.29376 XP_011925858.1.92194 ENSMMUP00000014569 ENSMMUP00000034227 9544.ENSMMUP00000034227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]