SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014595 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014595
Domain Number 1 Region: 18-46,89-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-21
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Domain Number 2 Region: 194-283
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-18
Family Voltage-gated potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014595   Gene: ENSMMUG00000011151   Transcript: ENSMMUT00000015584
Sequence length 408
Comment pep:known chromosome:MMUL_1:7:153281761:153406726:1 gene:ENSMMUG00000011151 transcript:ENSMMUT00000015584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANF
SRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPAT
VGGKIFLIFYGLVGCSSTILFFNLFLERLITVIAYIMKSCHQRQLRRRGALPQESLKDAG
QCEVDSLAGWKPSVYYVMLILCTASVLISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGF
GDLVSSQNAHYESQSLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCP
QCQRGLLRSRRNVVMPGSIRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASL
AILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR
Download sequence
Identical sequences A0A096NE39 A0A2K6B7E4 G7MYZ6 G7PB58
ENSMMUP00000014595 ENSMMUP00000014595 9544.ENSMMUP00000014595 ENSPANP00000011147 NP_001248575.1.72884 XP_011715557.1.29376 XP_011715558.1.29376 XP_011715559.1.29376 XP_015309607.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]