SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014811 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014811
Domain Number 1 Region: 34-101
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000714
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014811
Domain Number - Region: 142-179
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00314
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014811   Gene: ENSMMUG00000011296   Transcript: ENSMMUT00000015808
Sequence length 369
Comment pep:known chromosome:MMUL_1:19:41724121:41728117:-1 gene:ENSMMUG00000011296 transcript:ENSMMUT00000015808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPMLWLLLNFAAPALGFYFSISCPSGKQCQQALLSGNDILLYCNSSGAHWYYLFTQGKK
GRLASLTNISNMEIMPEGSLLIKDPSPSQTGLYHCWNKNGRQVVQYEIDFQDISTLHVTH
KDLGQRPLQNETLPLGSKELIFTRWEPWQDCNRCKEPGERKRLGYCYIEEPLKEAMPCWL
YLGEMLVWSSRLRPELQVEACHVRCTNNTQLRVDYVIFDNFRLDEETEFVWLDCPLGSMY
RPVYWHANDTPLTWESQLSGRDFTTFLDPSTGGRQLQVFQPAIYKCFVQQELVAQFNPAT
SPETLEAQWRENDAQWREARKALPGRADSVLKGLKLVLLVGTVLVLLGALLKFIRPSPGK
RSKQVLMVK
Download sequence
Identical sequences A0A2K6EA76 F6UPE6 G7PX85 Q4R7Z5
ENSMMUP00000014811 ENSMMUP00000014811 9544.ENSMMUP00000014811 NP_001180926.1.72884 NP_001271482.1.63531 XP_011763516.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]