SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014929 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014929
Domain Number 1 Region: 239-382
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 135-240
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-36
Family Second domain of FERM 0.000000825
Further Details:      
 
Domain Number 3 Region: 54-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-26
Family First domain of FERM 0.00000739
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014929   Gene: ENSMMUG00000011377   Transcript: ENSMMUT00000015930
Sequence length 711
Comment pep:known chromosome:MMUL_1:1:31726582:31856242:1 gene:ENSMMUG00000011377 transcript:ENSMMUT00000015930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAQEELREDPDFETKEGEGLEECSKIEVKEESPESKAEGELKASQKSIRKHRNMHCKVSL
LDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAIWDNATSKTWLDSAKEIKKQVR
GVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSE
LGDYDPELHGVDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMY
GVDLHKAKDLEGVDIILGVCSSGLLVYKDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQ
EQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQ
TRQASALIDRPAPHFERTASKRASRSLDGAAAVDSADRSPRPTSAPAIAQGQVAEGGVLD
ASAKKAVVPKAQKETVKAEVKKEDEPPEQAEPEPTEAWKVEKTHIEVTVPTSNGDQTQKL
AEKTEDLIRMRKKKRERLDGENIYIRHSNLMLEDLDKSQEEIRKHHASISELKKNFMESV
PEPRPSEWDKRLSTHSPFRTLNVNGQIPTGEGPPLVKTQTVTISDNTNAVKSEIPTKDVP
IVHTETKTITYEAAQVGHVSGHLSPRIPGLILLPRLVSNSWPQAFLLSQPSKTVKGGISE
TRIEKRIVITGDADIDHDQVLVQAIKEAKEQHPDMSVTKVVVHQETEIADE
Download sequence
Identical sequences ENSMMUP00000014929 ENSMMUP00000014929 9544.ENSMMUP00000014929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]