SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015364 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015364
Domain Number 1 Region: 1-227
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.41e-77
Family BAR domain 0.00000000167
Further Details:      
 
Domain Number 2 Region: 270-333
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-23
Family SH3-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015364   Gene: ENSMMUG00000011704   Transcript: ENSMMUT00000016396
Sequence length 338
Comment pep:known chromosome:MMUL_1:15:59129738:59179687:-1 gene:ENSMMUG00000011704 transcript:ENSMMUT00000016396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSMINTM
SKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIE
VKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESK
EIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASAQPRRE
YQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYDFEPENEGELGFKEG
DIITLTNQIDENWYEGMLHGHSGFFPINYVEILVALPH
Download sequence
Identical sequences ENSMMUP00000015364 9544.ENSMMUP00000015364 ENSMMUP00000015364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]