SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015546 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015546
Domain Number 1 Region: 243-483
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.34e-52
Family Crotonase-like 0.0000000892
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily Chromo domain-like 5.01e-17
Family Chromo domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015546   Gene: ENSMMUG00000011847   Transcript: ENSMMUT00000016596
Sequence length 499
Comment pep:known chromosome:MMUL_1:20:78757239:78834889:-1 gene:ENSMMUG00000011847 transcript:ENSMMUT00000016596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVERIVDKRKNKKGKWEYLIRWKGYGSTEDTWEPEHHLLHCEEFIDEFNGLHVSKDKRIK
SGKQSSTSKLLRDGRGPSVEKLSHRPSDPGKSKGTSHKRKRINPPLAKPKKGYSGKPPAG
GDRAAKTVSYRTTPSGLQIMPLKKAQNGMENGDAGSEKDERHFGNGSHQPGLDLNDHVGE
QDVGDCDVNHATLVENGLGSALTNGGLNLHSPVKRKLEAEKDYVFDKRLRYSVRQNESNC
RFRDIVVRKEEGFTHILLSSQTSDNNALTPEIMKEVRRALCNAATDDSKLLLLSAVGSVF
CSGLDYSYLIGRLSSDRRKESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGLGASILPL
CDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQEACSRGL
VSQVFWPTTFSQEVMLRVKEMASCSAVVLEESKCLVRSFLKSVLEDVNEKECLMLKQLWS
SSKGLDSLFSYLQDKIYEV
Download sequence
Identical sequences G7NR48 G7Q1Q5
ENSMMUP00000015546 9544.ENSMMUP00000015546 ENSMMUP00000015546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]