SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015690 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015690
Domain Number 1 Region: 1371-1683
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.05e-112
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000118
Further Details:      
 
Domain Number 2 Region: 1642-1940
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.26e-103
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000157
Further Details:      
 
Domain Number 3 Region: 329-523
Classification Level Classification E-value
Superfamily Fibronectin type III 1.8e-44
Family Fibronectin type III 0.00043
Further Details:      
 
Domain Number 4 Region: 521-664
Classification Level Classification E-value
Superfamily Fibronectin type III 9.32e-33
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 616-765
Classification Level Classification E-value
Superfamily Fibronectin type III 6.43e-29
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 6 Region: 833-1025
Classification Level Classification E-value
Superfamily Fibronectin type III 3.91e-25
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 241-335
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000158
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 188-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000228
Family I set domains 0.051
Further Details:      
 
Domain Number 9 Region: 85-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000045
Family I set domains 0.023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015690
Domain Number - Region: 1066-1112
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0441
Family Fibronectin type III 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015690   Gene: ENSMMUG00000011962   Transcript: ENSMMUT00000016755
Sequence length 1943
Comment pep:known chromosome:MMUL_1:19:5116724:5197386:-1 gene:ENSMMUG00000011962 transcript:ENSMMUT00000016755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTWGPGMVSVVGPMGLLVVLLIGGCAAEDQPAHPDEVNAIISIPKKVGNFLFQAGLDP
KAAWRRRRGLTRHREETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLT
VLRAQKHVPTGQGALGPGAPRKLSFSSFSYCMPGSALGARDADASFQSSLLQIGQWGVNG
RIKQLRSARLKSTPIRGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRGRERLRR
VAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLELTD
VKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITITWDSGNPDPVSY
YVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTG
EQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDD
SLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSIT
LSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVEDLKPNTEYAFRLAARSPQGL
GAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRPLG
SEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSA
PPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADA
QWETDDTAEYVSSTPGHPPTTVRFPRAVLSRQVDHLRSGPGVVVGALLGRPTLSVQQTPE
GSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVHKGATYVFRL
AARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAIVKY
TVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSPPV
RYRTFLRDQAPSLSPAQVSGHFSASSWSLKASPDPEAPALAKIQYNGLTLDVDGRTTKKL
ITHLKPHTFYNFVLTNRGSSLGGLQQTVTAWTAFNLLNGKPSVAPKPDADGFIMVYLPDG
QSPVPVQSYFIVMVPLRKSRGGQFLTPLGSPEDMDLEELIQDISRLQRRSLRHSRQLEVP
RPYIAARFSVLPPTFHPGDQKQYGGFDNRGLEPGHRYVLFVLAVLQKSEPTFAASPFSDP
FQLDNPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKPDSKRKDSEPRTKCLL
NNADLAPHHPKDPVEMRRINFQTPDSGLRSPLREPGFHFESMLSHPPIPIADMAEHTERL
KANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIVGSD
YINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYW
PNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPT
PFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMR
SQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFK
RLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYR
QQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYF
VVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHK
TKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQT
EDEYQFCYQAALEYLGSFDHYAT
Download sequence
Identical sequences 9544.ENSMMUP00000015696 ENSMMUP00000015696 ENSMMUP00000015690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]