SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016165 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016165
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily PX domain 1.83e-24
Family PX domain 0.002
Further Details:      
 
Domain Number 2 Region: 264-339
Classification Level Classification E-value
Superfamily MIT domain 1.16e-16
Family MIT domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016165   Gene: ENSMMUG00000012320   Transcript: ENSMMUT00000017261
Sequence length 342
Comment pep:known chromosome:MMUL_1:14:9424819:9427977:-1 gene:ENSMMUG00000012320 transcript:ENSMMUT00000017261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQFISKKDPEDVKEVVVWKRYSDFRKLHG
DLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLK
EFFRGGEVTRPSEMSRDLHILPPPLIPTPPPDDPRLPQPLPAERRGLEELEVPVDPPPSS
PAQEALDLLFNCESTEEASGSPARVPLTEAELALFDPFSKEEGAAPSPTHVAELATMEVE
SARLDQEPWEPGGQEEEEDGEGGPTPAYLSQATDLITQALRDEKAGAYAAALQGYRDGVH
VLLQGVPGDPLPARQEGVKKKAAEYLKRAEEILRLHLSQLPP
Download sequence
Identical sequences F7DG00
9544.ENSMMUP00000016166 ENSMMUP00000016165 XP_001114653.3.72884 ENSMMUP00000016166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]