SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016237 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016237
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.68e-58
Family Proteasome subunits 0.0000000033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016237   Gene: ENSMMUG00000012363   Transcript: ENSMMUT00000017336
Sequence length 205
Comment pep:known chromosome:MMUL_1:16:48779744:48791968:1 gene:ENSMMUG00000012363 transcript:ENSMMUT00000017336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAV
SGMGVIVHIIEKDKITTRTLKARMD
Download sequence
Identical sequences A0A096P574 A0A0D9S3F8 A0A2K5E9A9 A0A2K5LQE9 A0A2K5R9A1 A0A2K5XRB4 A0A2K6CWZ1 A0A2K6KCB5 A0A2K6QZB8 A0A2K6SXX7 F7EIY0 G1QIF0 G7PUK4 I3MMK5 U3ECA1
ENSPVAP00000002146 9544.ENSMMUP00000016237 ENSNLEP00000000693 ENSPVAP00000002146 ENSMMUP00000016237 NP_001244746.1.72884 XP_003278254.1.23891 XP_003931246.1.74449 XP_005321813.1.77405 XP_005584040.1.63531 XP_006924786.1.64745 XP_008011095.1.81039 XP_008579048.1.73410 XP_010377639.1.97406 XP_011723660.1.29376 XP_011840099.1.47321 XP_011901783.1.92194 XP_012307341.1.9421 XP_012621406.1.48125 XP_016020208.1.101085 XP_017352731.1.71028 XP_017734488.1.44346 ENSMMUP00000016237 ENSNLEP00000000693 ENSPANP00000020499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]