SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016246 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016246
Domain Number 1 Region: 60-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-88
Family Calnexin/calreticulin 0.00000000256
Further Details:      
 
Domain Number 2 Region: 269-409
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.54e-59
Family P-domain of calnexin/calreticulin 0.0000000326
Further Details:      
 
Domain Number 3 Region: 412-456
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000012
Family Calnexin/calreticulin 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016246   Gene: ENSMMUG00000012370   Transcript: ENSMMUT00000017347
Sequence length 592
Comment pep:known chromosome:MMUL_1:6:176366908:176400717:1 gene:ENSMMUG00000012370 transcript:ENSMMUT00000017347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKWLLCMLLVLGTVIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTY
KAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKESKLPGDKGL
VLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFH
DKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTL
ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVK
PDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKC
ESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFS
AVGLELWSMTSDIFFDNFIICADRRVVDDWANDGWGLKKAVDGAAEPGVVGQMIEAAEER
PWLWVVYILTVALPVFLVILFCCSGKKQTSAMEYKKTDAPQPDVKEEEEEKEEEKDKGDE
EEEGEEKLEEKQKSDAEEDGGTVSQEEEDRKPKAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences 9544.ENSMMUP00000016246 ENSMMUP00000016246 ENSMMUP00000016246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]