SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016356 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016356
Domain Number 1 Region: 7-286
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 5.1e-91
Family Inosine monophosphate dehydrogenase (IMPDH) 0.0000029
Further Details:      
 
Domain Number 2 Region: 328-399
Classification Level Classification E-value
Superfamily Inosine monophosphate dehydrogenase (IMPDH) 0.0000000000256
Family Inosine monophosphate dehydrogenase (IMPDH) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016356   Gene: ENSMMUG00000012455   Transcript: ENSMMUT00000017465
Sequence length 408
Comment pep:known chromosome:MMUL_1:7:87126287:87150040:1 gene:ENSMMUG00000012455 transcript:ENSMMUT00000017465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYTGVPIIAANMDTVGT
FEMAKVLCKFSLFTAVHKHYSLEEWQEFAGQNPDCLEHLAASSGTGASDFEQLEQILEAI
PQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGI
GPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVM
LGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRYVWRPRSLVIVWRQ
NSWLLRGGWYSSRSMVNQGSMLGSREKSLDLRNPEGGDNKVFPTLRASEGKTVEVPFKGD
VEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC
Download sequence
Identical sequences ENSMMUP00000016356 ENSMMUP00000016356 9544.ENSMMUP00000016356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]