SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016373 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016373
Domain Number 1 Region: 26-87
Classification Level Classification E-value
Superfamily Histone-fold 0.0000148
Family Archaeal histone 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016373   Gene: ENSMMUG00000012470   Transcript: ENSMMUT00000017483
Sequence length 292
Comment pep:known chromosome:MMUL_1:4:41903642:41922489:1 gene:ENSMMUG00000012470 transcript:ENSMMUT00000017483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRS
AKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALT
AGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMA
KTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEETDSSEQDEQTDTENLA
LHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKKPKIRRKK
Download sequence
Identical sequences 9544.ENSMMUP00000033697 ENSMMUP00000033697 ENSMMUP00000016373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]