SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016382 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016382
Domain Number 1 Region: 1324-1636
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000161
Further Details:      
 
Domain Number 2 Region: 1601-1889
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.06e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000619
Further Details:      
 
Domain Number 3 Region: 318-512
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-47
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 510-708
Classification Level Classification E-value
Superfamily Fibronectin type III 3.58e-39
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 5 Region: 863-998
Classification Level Classification E-value
Superfamily Fibronectin type III 2.59e-31
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 6 Region: 767-892
Classification Level Classification E-value
Superfamily Fibronectin type III 3.9e-27
Family Fibronectin type III 0.00000832
Further Details:      
 
Domain Number 7 Region: 32-134
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-18
Family I set domains 0.003
Further Details:      
 
Domain Number 8 Region: 230-323
Classification Level Classification E-value
Superfamily Immunoglobulin 8.68e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 9 Region: 135-227
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-16
Family I set domains 0.028
Further Details:      
 
Domain Number 10 Region: 1007-1090
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000487
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016382   Gene: ENSMMUG00000012477   Transcript: ENSMMUT00000017492
Sequence length 1897
Comment pep:known chromosome:MMUL_1:1:46453574:46532959:1 gene:ENSMMUG00000012477 transcript:ENSMMUT00000017492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPATS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGVEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPISYYGIQYRAAGTE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPSAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERI
IMYELVYWVAEDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEAR
TAQSTPSAPPQKVMCVSTGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRRRHVVD
GISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDGPSGPHSRPELEGY
QGVEVFLFSWPLPHLSQEVLQGIDILRVSGLYGGSRAMPCLHPQGFPRARETTISGLTPE
TTYSITVAAYTTKGDGARSKPKIVTTTGAVPGRPTVMVSTTAMNTALLQWHPPKDLPGEL
LGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAARNRAGLGEEFQKEIRT
PEDLPSGFPQNLRVTGLTTSTTELAWDPPVLAERNGRIVSYTVVFRDINSQQELQNITTD
THFTLSGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVLL
SWEVPDSYKSAVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNRGSSAGGLQHL
VSIRTAPDLLPHKPLPASAYIEDGRFALSMPHVQDPSLVRWFYIVVVPIDRVGGSMLAPR
WSTPEELELDELLEAIEQGGEEQRRRRRQAERLKPYVAAQLDVLPKTFTLGDKKNYRGFY
NRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEPEMLWVTGPVLA
VILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLNYQTPGMRDHP
PIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHS
RVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMT
RLEEKSRVKCDQYWPARGTETYGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQ
FMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKH
EKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLYAHIQKLGQV
PPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVE
GSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCH
QYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQGVPK
TGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQT
VKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
Download sequence
Identical sequences ENSMMUP00000016382 9544.ENSMMUP00000016382 ENSMMUP00000016382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]