SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016599 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016599
Domain Number 1 Region: 422-483
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.3e-16
Family LIM domain 0.0031
Further Details:      
 
Domain Number 2 Region: 480-550
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000109
Family LIM domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016599
Domain Number - Region: 392-425
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0677
Family LIM domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016599   Gene: ENSMMUG00000012635   Transcript: ENSMMUT00000017725
Sequence length 582
Comment pep:known chromosome:MMUL_1:3:180931666:180941845:1 gene:ENSMMUG00000012635 transcript:ENSMMUT00000017725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPPGSRLLRTGTQSPWTRRRGGHPRRGAHAPARARPGHGGPPPVSRDLRFGLGSGFLRP
PEEVRPCGGPKTQKNSWVRDFPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLE
EEIFPSPPPPLEEEGGPEAPIPSPPQPREKVSSIDLEIDSLSSLLDDMTKNDPFKARVSS
GYVPPPVATPFISKSSTKPAAGGTAPLPPWKAPSSSQPLPQVPAPAQSQTQFHVQPQPQP
KPQVQLHVQSQPQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKFSPGAPGGSGS
QPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPAPAQNQNQVRSPGAPGP
LTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACF
TCHQCAQQLQGQQFYSLEGAPYCESCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTC
VVCARPLEGTSFIVDQANRPHCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNF
HMKCYKCEDCGKPLSIEADDNGCFPLDGHVLCRKCHTARAQS
Download sequence
Identical sequences 9544.ENSMMUP00000016599 ENSMMUP00000016599 ENSMMUP00000016599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]