SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016958 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016958
Domain Number 1 Region: 529-896
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.76e-137
Family Hect, E3 ligase catalytic domain 0.00000000000981
Further Details:      
 
Domain Number 2 Region: 17-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.87e-24
Family PLC-like (P variant) 0.000000764
Further Details:      
 
Domain Number 3 Region: 434-468
Classification Level Classification E-value
Superfamily WW domain 0.00000000000153
Family WW domain 0.00072
Further Details:      
 
Domain Number 4 Region: 358-392
Classification Level Classification E-value
Superfamily WW domain 0.00000000000163
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 325-358
Classification Level Classification E-value
Superfamily WW domain 0.00000000000278
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 474-509
Classification Level Classification E-value
Superfamily WW domain 0.0000000000144
Family WW domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016958   Gene: ENSMMUG00000012912   Transcript: ENSMMUT00000018113
Sequence length 902
Comment pep:known chromosome:MMUL_1:10:30062583:30197497:-1 gene:ENSMMUG00000012912 transcript:ENSMMUT00000018113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSGSQLGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNT
NSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTL
QLGGDREPTETVGDLSICLDGLQLESEVVTNGETTCSESNVLLLLPRLECNGVFSAHCNF
CLPGSSDSPASASQVAGIAGASQNDDGSRSKDETRLSTNGSDDPEDAGAGENRRVSGNNS
PSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGSPSATSESDGSSTGSLPPTNTNTNTSEG
ATSGLIIPLTISGGSGPRPLNPVTQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPL
PPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIY
GNQDLFATSQSKEFDPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWDPRSQGQLNEKPLP
EGWEMRFTVDGIAYFVDHNRRTTTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQ
LAMPQHIKITVTRKTLFEDSFQQIMSLSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLS
HEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKIIDTSFSL
PFYKRILSKPVGLKDLESIDPEFYNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLK
PNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYVQYFDAKELEVL
LCGMQEIDLNEWQRHAIYRHYTRTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPLGG
FADLMGINGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFG
QE
Download sequence
Identical sequences 9544.ENSMMUP00000016958 ENSMMUP00000016958 ENSMMUP00000016958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]